COA6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COA6 Polyclonal antibody, PBS Only (24209-1-PBS)

• 

  WB analysis of HEK-293 using 24209-1-AP (same clone as 24209-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 24209-1-AP (same clone as 24209-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 24209-1-AP (same clone as 24209-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24209-1-AP (COA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 24209-1-AP (same clone as 24209-1-PBS)

  IP result of anti-COA6 (IP:24209-1-AP, 4ug; Detection:24209-1-AP 1:500) with HEK-293 cells lysate 1760ug. This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24209-1-AP (same clone as 24209-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24209-1-AP (COA6 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24209-1-AP (same clone as 24209-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24209-1-AP (COA6 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 24209-1-AP (same clone as 24209-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using C1orf31 antibody (24209-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24209-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COA6 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 24209-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

C1orf31

---

Product Information

24209-1-PBS targets COA6 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21525

  Product name: Recombinant human C1orf31 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 47-125 aa of BC116455

  Sequence: MAAPSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTAKS

• Full Name: chromosome 1 open reading frame 31
• Calculated Molecular Weight: 125 aa, 14 kDa
• Observed Molecular Weight: 10 - 18 kDa
• GenBank Accession Number: BC116455
• Gene Symbol: COA6
• Gene ID (NCBI): 388753
• RRID: AB_2879459
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q5JTJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

C1orf31, also known as COA6, is a conserved mitochondrial protein required for respiratory complex IV biogenesis. Recently study reported that C1orf31 is required for maintenance of cytochrome c oxidase (CcO) subunit levels, and has role in the Cu delivery pathway to CcO. Defects in C1orf31 is associated with mitochondrial respiratory chain disease (MRCD). (24549041)