COBLL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COBLL1 Polyclonal antibody, PBS Only (31191-1-PBS)

• 

  WB analysis using 31191-1-AP (same clone as 31191-1-PBS)

  Various lysates were subjected to Tris-Acetate gel system followed by western blot with 31191-1-AP (COBLL1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31191-1-AP (same clone as 31191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31191-1-AP (COBLL1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 31191-1-AP (same clone as 31191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 31191-1-AP (COBLL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31191-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 31191-1-AP (same clone as 31191-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31191-1-AP (COBLL1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31191-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 31191-1-AP (same clone as 31191-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HaCaT cells using COBLL1 antibody (31191-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 31191-1-PBS in a different storage buffer formulation.

COBLL1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31191-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

COBL like 1, COBLR1, Cordon bleu protein like 1, KIAA0977

---

Product Information

31191-1-PBS targets COBLL1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34853

  Product name: Recombinant human COBLL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 990-1128 aa of BC071588

  Sequence: LAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVSDKENNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPDAQDGH

• Full Name: COBL-like 1
• Observed Molecular Weight: 160 kDa
• GenBank Accession Number: BC071588
• Gene Symbol: COBLL1
• Gene ID (NCBI): 22837
• RRID: AB_3669891
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q53SF7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cordon-blue protein-like 1 (COBLL1), a negative regulator of apoptosis, is associated with lower insulin resistance. COBLL1 is involved in the cancer cell morphogenesis to a neuron-like cell shape observed in the CRPC model cells, promoting cell growth and migration (PMID: 29686105, 29686105). COBLL1 is highly expressed in most human tissues including lung, liver, kidney, pancreas, ovary, spinal cord and brain.