COG5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COG5 Polyclonal antibody, PBS Only (31380-1-PBS)

• 

  WB analysis using 31380-1-AP (same clone as 31380-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31380-1-AP (COG5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31380-1-PBS in a different storage buffer formulation.

COG5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31380-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Golgi transport complex 1, GOLTC1, GTC90

---

Product Information

31380-1-PBS targets COG5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35394

  Product name: Recombinant human COG5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-200 aa of NM_181733.2

  Sequence: MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREI

• Full Name: component of oligomeric golgi complex 5
• Calculated Molecular Weight: 93kDa，839aa
• Observed Molecular Weight: 87-93 kDa
• GenBank Accession Number: NM_181733.2
• Gene Symbol: COG5
• Gene ID (NCBI): 10466
• RRID: AB_3742422
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9UP83
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COG5 (Component Of Oligomeric Golgi Complex 5) is part of an eight-subunit Golgi-resident protein referred to as the conserved oligomeric golgi (COG) complex, which facilitates retrograde Golgi trafficking of vesicles that may include necessary glycosylation enzymes (PMID: 33277529). COG5 knockdown led to marked increases indicative of aberrant glycosylation (PMID: 25331899). The 92- and 87-kDa polypeptides could also be alternatively spliced isoforms of GTC-90 (PMID: 9792665)