COIL Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67218-1-Ig (same clone as 67218-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67218-1-Ig (same clone as 67218-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67218-1-Ig (same clone as 67218-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67218-1-Ig (same clone as 67218-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67218-1-Ig (same clone as 67218-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using COIL antibody (67218-1-Ig, Clone: 2G12B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67218-1-Ig (same clone as 67218-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COIL antibody (67218-1-Ig, Clone: 2G12B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 67218-1-Ig (same clone as 67218-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human COIL (67218-1-Ig, Clone:2G12B8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67218-1-PBS in a different storage buffer formulation.

COIL Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67218-1-PBS

Clone No.2G12B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

Coilin, 2G12B8, CLN80, p80 coilin, p80-coilin

---

Product Information

67218-1-PBS targets COIL in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17171

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• RRID: AB_2882509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P38432
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.