COIL Monoclonal antibody

• 

  WB analysis of HeLa using 67218-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67218-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 67218-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 67218-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67218-1-Ig (COIL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 67218-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using COIL antibody (67218-1-Ig, Clone: 2G12B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  IF Staining of HepG2 using 67218-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COIL antibody (67218-1-Ig, Clone: 2G12B8 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red).

• 

  FC experiment of HeLa using 67218-1-Ig

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human COIL (67218-1-Ig, Clone:2G12B8) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Mouse IgG1 Isotype Control (MOPC-21) (65124-1-Ig, Clone: MOPC-21) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

COIL Monoclonal Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 67218-1-Ig

Clone No.2G12B8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

Coilin, 2G12B8, CLN80, p80 coilin, p80-coilin

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67218-1-Ig targets COIL in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17171

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• RRID: AB_2882509
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P38432
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.