COIL Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA sample test of MP02891-1

  The mean Coilin concentration was determined to be 19.9 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load and 9.6 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02891-1

  Sandwich ELISA standard curve of MP02891-1, Human Coilin Recombinant Matched Antibody Pair - PBS only. 87171-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1416. 87171-1-PBS was HRP conjugated as the detection antibody. Range: 39.1-2500 pg/mL.

• 

  Cytometric bead array sample test of MP02891-1

  The mean COIL/Coilin concentration was determined to be 63.3 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load, 29.8 ng/mL in Jurkat cell extract based on a 1.2 mg/mL extract load, 88.3 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02891-1

  Cytometric bead array standard curve of MP02891-1, COIL/Coilin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87171-2-PBS. Detection antibody: 87171-1-PBS. Standard: Ag1416. Range: 0.312-40 ng/mL.

COIL Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87171-2-PBS

Clone No.252327D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

---

Product Information

87171-2-PBS targets COIL as part of a matched antibody pair:

MP02891-1: 87171-2-PBS capture and 87171-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1416

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P38432
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.