Collagen Type XXVI Polyclonal antibody

Collagen Type XXVI Polyclonal Antibody for IHC, IF/ICC, ELISA
Cat No. 21106-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

COL26A1, EMID2, Collagen alpha 1(XXVI) chain, EMI domain containing 2, EMI6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21106-1-AP targets Collagen Type XXVI in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15382

Product name: Recombinant human EMID2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 118-247 aa of BC110393

Sequence: GFTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDFLPDAIPLAHPVPRQRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQTGEKGPAGPPGLLGPPGPRGLPGEM

Predict reactive species
Full Name EMI domain containing 2
Calculated Molecular Weight 441 aa, 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC110393
Gene Symbol EMID2
Gene ID (NCBI) 136227
RRIDAB_3669359
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96A83
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COL26A1(Collagen alpha-1(XXVI) chain), also known as EMID2. It is expected to be located in the cytoplasm and extracellular space. COL26A1 is expressed in many tissues, especially in brain tissues, including cerebral cortex, cerebellum and basal ganglia. In the single cell type, the expression of COL26A1 is mainly concentrated in excitatory and inhibitory neurons. The protein is a new member of the collagen family. Its function has not been fully demonstrated in thyroid cancer (THCA), but it is known that collagen can promote cancer progression. COL26A1 may be involved in immune-related pathways, such as CTLA4 pathway, IL-10 signaling pathway and chemokine receptor binding chemokine. The molecular weight of COL26A1 is 45 kDa. COL26A1 is significantly up-regulated in thyroid carcinoma, and its high expression is related to poor prognosis. It is also significantly related to tumor microenvironment, which may involve immune-related pathways in the process of tumor occurrence(PMID: 38197076).

Protocols

Product Specific Protocols
IF protocol for Collagen Type XXVI antibody 21106-1-APDownload protocol
IHC protocol for Collagen Type XXVI antibody 21106-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...