COL6A3 Recombinant monoclonal antibody, PBS Only

COL6A3 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 83010-1-PBS
Clone No.230540A11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

COL6A3-Specific, 230540A11, Collagen alpha 3(VI) chain, Collagen alpha-3(VI) chain, Collagen Type VI

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83010-1-PBS targets COL6A3 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34752

Product name: Recombinant human COL6A3-Specific protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1630-1850 aa of NM_004369

Sequence: PSRPEKKKADIVFLLDGSINFRRDSFQEVLRFVSEIVDTVYEDGDSIQVGLVQYNSDPTDEFFLKDFSTKRQIIDAINKVVYKGGRHANTKVGLEHLRVNHFVPEAGSRLDQRVPQIAFVITGGKSVEDAQDVSLALTQRGVKVFAVGVRNIDSEEVGKIASNSATAFRVGNVQELSELSEQVLETLHDAMHETLCPGVTDAAKACNLDVILGFDGSRDQN

Predict reactive species
Full Name collagen, type VI, alpha 3
Calculated Molecular Weight 344 kDa
Observed Molecular Weight300 kDa
GenBank Accession NumberNM_004369
Gene Symbol COL6A3
Gene ID (NCBI) 1293
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP12111
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COL6A3 belongs to the type VI collagen family. Collagen VI acts as a cell-binding protein. It is expected to be expressed in smooth muscle. And the calculated molecular weight of COL6A3 is 343 kDa. The protein has similar expression in obese and T2DM (2 patients, and it regulates the chemotaxis and inflammation of macrophages in adipose tissue. Its expression is also related to weight gain. The expression of this protein in adipocytes is related to insulin resistance, which is believed to depend on PPAR (peroxisome proliferator-activated receptor) α-mediated adipocyte development (PMID: 25337653). Defects in COL6A3 are a cause of Bethlem myopathy (BM). Defects in COL6A3 are a cause of Ullrich congenital muscular dystrophy (UCMD) which also known as Ullrich scleroatonic muscular dystrophy. This antibody is specific to COL6A3.

Loading...
||
New chat Able
正在加载,请稍候...