COLEC11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COLEC11 Polyclonal antibody, PBS Only (15269-1-PBS)

• 

  WB analysis of mouse liver using 15269-1-AP (same clone as 15269-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human plasma using 15269-1-AP (same clone as 15269-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 15269-1-AP (same clone as 15269-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 15269-1-AP (COLEC11 Antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 15269-1-AP (same clone as 15269-1-PBS)

  IP result of anti-COLEC11 (IP:15269-1-AP, 4ug; Detection:15269-1-AP 1:500) with mouse liver tissue lysate 6400ug. This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15269-1-AP (same clone as 15269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15269-1-AP (COLEC11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15269-1-AP (same clone as 15269-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15269-1-AP (COLEC11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

• 

  IF Staining of ATCD5 cells using 15269-1-AP (same clone as 15269-1-PBS)

  IF result (confocal image) of CL-K1 in ATCD5 cell show Golgi localization from Prof. Philip L. Beales. This data was developed using the same antibody clone with 15269-1-PBS in a different storage buffer formulation.

COLEC11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15269-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

15269-1-PBS targets COLEC11 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7374

  Product name: Recombinant human COLEC11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 18-271 aa of BC000078

  Sequence: SLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM

• Full Name: collectin sub-family member 11
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000078
• Gene Symbol: COLEC11
• Gene ID (NCBI): 78989
• RRID: AB_10732940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BWP8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COLEC11, also named as CL-K1 and Collectin-11, belongs to the COLEC10/COLEC11 family. It is a lectin that binds to various sugars: fucose > mannose. It does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. COLEC11 binds to LPS. COLEC11 and MASP1 are two genes in the lectin complement pathway, they are mutated in 3MC syndrome, implicating this diverse inflammation-chemotaxis cascade in the etiology of human developmental disorders. COLEC11 serves as a guidance cue for neural crest cell migration.(PMID:21258343)