• Featured Product
  • KD/KO Validated

COMMD4 Recombinant monoclonal antibody, PBS Only (Capture)

COMMD4 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 84664-3-PBS
Clone No.242175E4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

242175E4, COMM domain containing 4, COMMD 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84664-3-PBS targets COMMD4 as part of a matched antibody pair:

MP01475-1: 84664-3-PBS capture and 84664-2-PBS detection (validated in Cytometric bead array)

MP01475-2: 84664-3-PBS capture and 84664-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag34904

Product name: Recombinant human COMMD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-199 aa of BC068998

Sequence: MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLMSSLG

Predict reactive species
Full Name COMM domain containing 4
Observed Molecular Weight22 kDa
GenBank Accession NumberBC068998
Gene Symbol COMMD4
Gene ID (NCBI) 54939
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H0A8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COMMD4 is a protein-coding gene belonging to the COMMD family and is highly expressed in non-small cell lung cancer (NSCLC) and hepatocellular carcinoma (HCC) (PMID: 36249824). It has 3 isoforms and has been shown to control NF-κB activity and regulate the activity of cullin-RING E3 ubiquitin ligases (PMID: 32439936).

Loading...
||
New chat Able
正在加载,请稍候...