COMT Monoclonal antibody

• 

  WB analysis using 68181-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68181-1-Ig (COMT antibody) at dilution of 1:10000 and incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IF Staining of mouse cerebellum using 68181-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse cerebellum tissue using COMT antibody (68181-1-Ig, Clone: 1A1A4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

COMT Monoclonal Antibody for WB, IF-P, ELISA

Cat No. 68181-1-Ig

Clone No.1A1A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF-P, ELISA

Synonyms

1A1A4, catechol O methyltransferase, Catechol O-methyltransferase, EC:2.1.1.6

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, K-562 cells, pig adrenal gland tissue, human testis tissue, rat testis tissue, mouse testis tissue
• Positive IF-P detected in: mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68181-1-Ig targets COMT in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6502

  Product name: Recombinant human COMT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-182 aa of BC000419

  Sequence: MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

• Full Name: catechol-O-methyltransferase
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC000419
• Gene Symbol: COMT
• Gene ID (NCBI): 1312
• RRID: AB_2935272
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P21964
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Catechol O-methyltransferase (COMT) is an important enzyme that catalyzes O-methylation and inactivation of metabolically active catechol-containing bioactive molecules and drugs. The mammalian COMT enzyme exists in soluble form (24-26 kDa) and membrane-bound form (28-30 kDa), which are encoded by a single gene utilizing different promoters.