COPG2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COPG2 Polyclonal antibody, PBS Only (16111-1-PBS)

• 

  WB analysis of mouse heart using 16111-1-AP (same clone as 16111-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 16111-1-AP (same clone as 16111-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 16111-1-AP (same clone as 16111-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16111-1-AP (same clone as 16111-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 16111-1-AP (same clone as 16111-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 16111-1-AP (same clone as 16111-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 16111-1-AP (same clone as 16111-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16111-1-AP (COPG2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 16111-1-AP (COPG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cerebellum using 16111-1-AP (same clone as 16111-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cerebellum using 16111-1-AP (COPG2 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 16111-1-PBS in a different storage buffer formulation.

COPG2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 16111-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

16111-1-PBS targets COPG2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9034

  Product name: Recombinant human COPG2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 517-865 aa of BC017443

  Sequence: EVRDRATFYLNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEPSEKPFDMKSIPLAMAPVFEQKAEITLVATKPEKLAPSRQDIFQEQLAAIPEFLNIGPLFKSSEPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPSDSYEVLSCIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNTGVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALADGVTMQVTVRSKERTPVDVILASVG

• Full Name: coatomer protein complex, subunit gamma 2
• Calculated Molecular Weight: 871 aa, 98 kDa
• Observed Molecular Weight: 98 kDa
• GenBank Accession Number: BC017443
• Gene Symbol: COPG2
• Gene ID (NCBI): 26958
• RRID: AB_10897182
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBF2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.