CoraLite®594-conjugated COPS2 Monoclonal antibody

COPS2 Monoclonal Antibody for IF-P
Cat No. CL594-66435
Clone No.2H10E6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF-P

ALIEN, Alien homolog, COPS2, CSN2, SGN2, Signalosome subunit 2, TR interacting protein 15, TRIP 15, TRIP15

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman ovary cancer cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66435 targets COPS2 in IF-P applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag1415

Product name: Recombinant human COPS2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-443 aa of BC012629

Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

Predict reactive species
Full Name COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis)
Calculated Molecular Weight 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC012629
Gene Symbol COPS2
Gene ID (NCBI) 9318
RRIDAB_2919990
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP61201
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

COPS2 is an essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively.

Protocols

Product Specific Protocols
IF protocol for CL594 COPS2 antibody CL594-66435Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...