COPS7B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COPS7B Polyclonal antibody, PBS Only (32695-1-PBS)

• 

  WB analysis using 32695-1-AP (same clone as 32695-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32695-1-AP (COPS7B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32695-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 32695-1-AP (same clone as 32695-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32695-1-AP (COPS7B antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32695-1-PBS in a different storage buffer formulation.

COPS7B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32695-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

COP9 signalosome complex subunit 7b, CSN7B, JAB1-containing signalosome subunit 7b, SGN7b, Signalosome subunit 7b

---

Product Information

32695-1-PBS targets COPS7B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38543

  Product name: Recombinant human COPS7B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 100-264 aa of NM_022730.3

  Sequence: TIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH*

• Full Name: COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)
• Calculated Molecular Weight: 30 kDa，264 aa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: NM_022730.3
• Gene Symbol: COPS7B
• Gene ID (NCBI): 64708
• RRID: AB_3742712
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9H9Q2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COP9 signalosome complex subunit 7b (COPS7B, also known as CSN7B) is a component of the ribo-interactome that interacts with ribosomes to facilitate ribosome biogenesis and mRNA translation initiation (PMID: 27903243). Increased expression of COPS7B mediated by IGF2BP3 elevates the translational efficiency of genes enriched in mRNA translation and ribosome biogenesis pathways, promoting protein synthesis and driving progression in colorectal cancer (PMID: 37560971).