CoraLite® Plus 488-conjugated COPS8 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• CoraLite® Plus 488-conjugated COPS8 Recombinant monoclonal antibody (CL488-83312)

COPS8 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83312 Copied!

Clone No. 240195B1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

COP9, 240195B1, COPS8/COP9, CSN8, hCOP9

• 

  IF Staining of HeLa using CL488-83312

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 COPS8 antibody (CL488-83312, Clone: 240195B1 ) at dilution of 1:200.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COPS8 in ?

Chat with Able

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83312 targets COPS8 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0143

  Product name: Recombinant human COPS8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 14-194 aa of BC003090

  Sequence: KKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNE

• Full Name: COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC003090
• Gene Symbol: COPS8
• Gene ID (NCBI): 10920
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99627
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

COPS8 is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases.