COQ10A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COQ10A Polyclonal antibody, PBS Only (17812-1-PBS)

• 

  WB analysis of human heart using 17812-1-AP (same clone as 17812-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17812-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 17812-1-AP (same clone as 17812-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17812-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 17812-1-AP (same clone as 17812-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 17812-1-AP (COQ10A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17812-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 17812-1-AP (same clone as 17812-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using COQ10A antibody (17812-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 17812-1-PBS in a different storage buffer formulation.

COQ10A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 17812-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Coenzyme Q-binding protein COQ10 homolog A, mitochondrial

---

Product Information

17812-1-PBS targets COQ10A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12126

  Product name: Recombinant human COQ10A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-247 aa of BC073923

  Sequence: MAWAGSRRVPAGTRAAAERCCRLSLSPGAQPAPPPGPLPPPRPMRFLTSCSLLLPRAAQILAAEAGLPSSRSFMGFAAPFTNKRKAYSERRIMGYSMQEMYEVVSNVQEYREFVPWCKKSLVVSSRKGHLKAQLEVGFPPVMERYTSAVSMVKPHMVKAVCTDGKLFNHLETIWRFSPGIPAYPRTCTVDFSISFEFRSLLHSQLATMFFDEVVKQNVAAFERRAATKFGPETAIPRELMFHEVHQT

• Full Name: coenzyme Q10 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 247 aa, 28 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC073923
• Gene Symbol: COQ10A
• Gene ID (NCBI): 93058
• RRID: AB_2081926
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96MF6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.