COQ5 Recombinant monoclonal antibody, PBS Only

COQ5 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85890-1-PBS
Clone No.250140E11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial, EC:2.1.1.201, Ubiquinone biosynthesis methyltransferase COQ5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85890-1-PBS targets COQ5 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10203

Product name: Recombinant human COQ5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-327 aa of BC107874

Sequence: MAAPGSCALWSYCGRGWSRAMRGCQLLGLRSSWPGDLLSARLLSQEKRAAETHFGFETVSEEEKGGKVYQVFESVAKKYDVMNDMMSLGIHRVWKDLLLWKMHPLPGTQLLDVAGGTGDIAFRFLNYVQSQHQRKQKRQLRAQQNLSWEEIAKEYQNEEDSLGGSRVVVCDINKEMLKVGKQKALAQGYRAGLAWVLGDAEELPFDDDKFDIYTIAFGIRNVTHIDQALQEAHRVLKPGGRFLCLEFSQVNNPLISRLYDLYSFQVIPVLGEVIAGDWKSYQYLVESIRRFPSQEEFKDMIEDAGFHKVTYESLTSGIVAIHSGFKL

Predict reactive species
Full Name coenzyme Q5 homolog, methyltransferase (S. cerevisiae)
Calculated Molecular Weight 327 aa, 37 kDa
Observed Molecular Weight32 kDa
GenBank Accession NumberBC107874
Gene Symbol COQ5
Gene ID (NCBI) 84274
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ5HYK3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

COQ5 catalyzes the only C-methylation involved in the biosynthesis of coenzyme Q (Q or ubiquinone) in humans and yeast Saccharomyces cerevisiae. In humans, mutations in several COQ genes cause primary Q deficiency, and a decrease in Q biosynthesis is associated with mitochondrial, cardiovascular, kidney and neurodegenerative diseases (PMID: 25152161). Endogenous human COQ5 protein primarily existed as a mature form (m-COQ5, ~32 kDa) without the mitochondrial targeting sequence (MTS) in the mitochondria of human cells, in addition to the minor precursor form (p-COQ5, 37 kDa) of the full-length protein (PMID: 27155576).

Loading...
||
New chat Able
正在加载,请稍候...