CORO1C Polyclonal antibody

• 

  WB analysis of mouse heart using 14749-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14749-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 14749-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 14749-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14749-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SGC-7901 using 14749-1-AP

  SGC-7901 cells were subjected to SDS PAGE followed by western blot with 14749-1-AP (CORO1C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse skeletal muscle using 14749-1-AP

  IP result of anti-CORO1C (IP:14749-1-AP, 4ug; Detection:14749-1-AP 1:500) with mouse skeletal muscle tissue lysate 3600ug.

• 

  IP experiment of mouse heart using 14749-1-AP

  IP result of anti-CORO1C (IP:14749-1-AP, 4ug; Detection:14749-1-AP 1:3000) with mouse heart tissue lysate 1680 ug.

• 

  IHC staining of human cervical cancer using 14749-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14749-1-AP (CORO1C antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 14749-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 14749-1-AP (CORO1C antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 14749-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 14749-1-AP (CORO1C antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 14749-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CORO1C antibody (14749-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

CORO1C Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14749-1-AP

Publications(14)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Coronin 1C, Coronin 3, Coronin-1C, Coronin-3, CRN2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human heart tissue, SGC-7901 cells, HeLa cells, mouse skeletal muscle tissue
• Positive IP detected in: mouse heart tissue, mouse skeletal muscle tissue
• Positive IHC detected in: human cervical cancer tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 13 publications below
• IHC: See 5 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

14749-1-AP targets CORO1C in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6488

  Product name: Recombinant human CORO1C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-306 aa of BC002342

  Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN

• Full Name: coronin, actin binding protein, 1C
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC002342
• Gene Symbol: CORO1C
• Gene ID (NCBI): 23603
• RRID: AB_2230110
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULV4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell; Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules; Authors - Qinqin Cui
monkey	WB	Cell; A Novel Class of ER Membrane Proteins Regulates ER-Associated Endosome Fission.; Authors - Melissa J Hoyer ; KD Validated
human	WB	J Cell Biol; Coronin 1C restricts endosomal branched actin to organize ER contact and endosome fission.; Authors - Jonathan F Striepen
mouse	WB	Hum Mol Genet; Proteomic analysis reveals co-ordinated alterations in protein synthesis and degradation pathways in LRRK2 knockout mice.; Authors - Laura Pellegrini
human	WB,IHC	Front Mol Biosci; CORO1C is Associated With Poor Prognosis and Promotes Metastasis Through PI3K/AKT Pathway in Colorectal Cancer.; Authors - Zongxia Wang
human	WB	Genes (Basel); Coronin 1C, Regulated by Multiple microRNAs, Facilitates Cancer Cell Aggressiveness in Pancreatic Ductal Adenocarcinoma; Authors - Kosuke Fukuda

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Wen (Verified Customer) (12-22-2019)

Work well in western blot

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: mouse haematopoietic cells