CORO1C Monoclonal antibody

• 

  WB analysis using 68846-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68846-1-Ig (CORO1C antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 68846-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68846-1-Ig (CORO1C antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of SH-SY5Y using 68846-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CORO1C antibody (68846-1-Ig, Clone: 1B10G4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002).

CORO1C Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68846-1-Ig

Clone No.1B10G4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

CRN2, Coronin-3, Coronin-1C, Coronin 3, Coronin 1C

---

Tested Applications

• Positive WB detected in: hTERT-RPE1 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, MDA-MB-231 cells, A549 cells, A431 cells, HepG2 cells
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68846-1-Ig targets CORO1C in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6546

  Product name: Recombinant human CORO1C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-306 aa of BC002342

  Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN

• Full Name: coronin, actin binding protein, 1C
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC002342
• Gene Symbol: CORO1C
• Gene ID (NCBI): 23603
• RRID: AB_3670439
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULV4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047).