CORO1C Monoclonal antibody, PBS Only

• 

  WB analysis using 68846-1-Ig (same clone as 68846-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68846-1-Ig (CORO1C antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68846-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68846-1-Ig (same clone as 68846-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68846-1-Ig (CORO1C antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68846-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 68846-1-Ig (same clone as 68846-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CORO1C antibody (68846-1-Ig, Clone: 1B10G4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68846-1-PBS in a different storage buffer formulation.

CORO1C Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68846-1-PBS

Clone No.1B10G4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

CRN2, Coronin-3, Coronin-1C, Coronin 3, Coronin 1C

---

Product Information

68846-1-PBS targets CORO1C in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6546

  Product name: Recombinant human CORO1C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-306 aa of BC002342

  Sequence: MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRIDKSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHPTARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVAEKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSIIYLCGKGDSSIRYFEITDESPYVHYLN

• Full Name: coronin, actin binding protein, 1C
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC002342
• Gene Symbol: CORO1C
• Gene ID (NCBI): 23603
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULV4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CORO1C also known as HCRNN4, belongs to the WD repeat coronin family. CORO1C contains 5 N-terminal trp-asp (WD) repeats and a C-terminal coiled-coil motif. It was reported to regulate actin‐dependent processes by assembling F-actin. CORO1C promoted the invasion of breast cancer and glioma cells by specifically promoting the formation of invadopodia(PMID: 30974047).