CORO2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CORO2A Polyclonal antibody, PBS Only (10119-1-PBS)

• 

  WB analysis using 10119-1-AP (same clone as 10119-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10119-1-AP (CORO2A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10119-1-AP (same clone as 10119-1-PBS)

  WB result of CORO2A antibody (10119-1-AP; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CORO2A transfected Jurkat cells. This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 10119-1-AP (same clone as 10119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 10119-1-AP (CORO2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 10119-1-AP (same clone as 10119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 10119-1-AP (CORO2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 10119-1-AP (same clone as 10119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 10119-1-AP (CORO2A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 10119-1-AP (same clone as 10119-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 10119-1-AP (CORO2A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10119-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CORO2A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10119-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

10119-1-PBS targets CORO2A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0164

  Product name: Recombinant human CORO2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 293-523 aa of BC000010

  Sequence: GNIRYYEVSADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGAQPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMPRWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSE

• Full Name: coronin, actin binding protein, 2A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000010
• Gene Symbol: CORO2A
• Gene ID (NCBI): 7464
• RRID: AB_2877724
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92828
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CORO2A (Coronin 2A), also named as CLIPINB, is a member of the 'short' coronin subfamily containing a single WD40-repeat domain. It has been shown that the expression of CORO2A is up-regulated in human colon cancer. CORO2A can interact with MAPK14 and PRMT5. The calculated MW of CORO2A is 60 kDa, while 10119-1-AP antibody detects 48 kDa protein which is similar to the paper published. (PMID: 26373535)