CORO2B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CORO2B Polyclonal antibody, PBS Only (13802-1-PBS)

• 

  WB analysis of Jurkat using 13802-1-AP (same clone as 13802-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13802-1-AP (CORO2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 13802-1-AP (same clone as 13802-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13802-1-AP (CORO2B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 13802-1-AP (same clone as 13802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 13802-1-AP (CORO2B antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 13802-1-AP (same clone as 13802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovarian cancer slide using 13802-1-AP (CORO2B antibody) at dilution of 1:1600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13802-1-AP (same clone as 13802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13802-1-AP (CORO2B Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 13802-1-AP (same clone as 13802-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 13802-1-AP (CORO2B Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13802-1-PBS in a different storage buffer formulation.

CORO2B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13802-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Protein FC96, KIAA0925, Coronin-like protein C, Coronin-2B, Coronin 2B

---

Product Information

13802-1-PBS targets CORO2B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4793

  Product name: Recombinant human CORO2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-331 aa of BC026335

  Sequence: MSWRPQYRSSKFRNVYGKVANREHCFDGIPITKNVHDNHFCAVNTRFLAIVTESAGGGSFLVIPLEQTGRIEPNYPKVCGHQGNVLDIKWNPFIDNIIASCSEDTSVRIWEIPEGGLKRNMTEALLELHGHSRRVGLVEWHPTTNNILFSAGYDYKVLIWNLDVGEPVKMIDCHTDVILCMSFNTDGSLLTTTCKDKKLRVIEPRSGRVLQEANCKNHRVNRVVFLGNMKRLVTTGVSRWNTRQIALWDQEDLSMPLIEEEIDGLSGLLFPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGVMPKHGLDVSACE

• Full Name: coronin, actin binding protein, 2B
• Calculated Molecular Weight: 475 aa, 54 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC026335
• Gene Symbol: CORO2B
• Gene ID (NCBI): 10391
• RRID: AB_2087042
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UQ03
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.