COX-1/Cyclooxygenase-1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84151-4-RR (same clone as 84151-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84151-4-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 84151-4-RR (same clone as 84151-4-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84151-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 84151-4-RR (same clone as 84151-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84151-4-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse stomach using 84151-4-RR (same clone as 84151-4-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84151-4-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 84151-4-RR (same clone as 84151-4-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed C2C12 cells using COX-1/Cyclooxygenase-1 antibody (84151-4-RR, Clone: 241373C10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84151-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84151-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84151-4-RR against Human COX-1/Cyclooxygenase-1 were performed. The affinity constant is below 1 pM.

COX-1/Cyclooxygenase-1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84151-4-PBS

Clone No.241373C10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PGH1, PTGS1, 241373C10, COX1, Cyclooxygenase-1

---

Product Information

84151-4-PBS targets COX-1/Cyclooxygenase-1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4055

  Product name: Recombinant human PTGS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-599 aa of BC029840

  Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

• Full Name: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 60-72 kDa
• GenBank Accession Number: BC029840
• Gene Symbol: PTGS1
• Gene ID (NCBI): 5742
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P23219
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PTGS1(Prostaglandin G/H synthase 1) belongs to the prostaglandin G/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.