COX-1/Cyclooxygenase-1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• COX-1/Cyclooxygenase-1 Recombinant monoclonal antibody (84151-4-RR)

COX-1/Cyclooxygenase-1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84151-4-RR

Clone No.241373C10

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PGH1, PTGS1, 241373C10, COX1, Cyclooxygenase-1

• 

  WB analysis using 84151-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of THP-1 using 84151-4-RR

  THP-1 cells were subjected to SDS PAGE followed by western blot with 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 84151-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 84151-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 84151-4-RR (COX-1/Cyclooxygenase-1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of C2C12 using 84151-4-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed C2C12 cells using COX-1/Cyclooxygenase-1 antibody (84151-4-RR, Clone: 241373C10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 84151-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84151-4-RR against Human COX-1/Cyclooxygenase-1 were performed. The affinity constant is below 1 pM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: C2C12 cells, THP-1 cells, NIH/3T3 cells
• Positive IHC detected in: mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: C2C12 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84151-4-RR targets COX-1/Cyclooxygenase-1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4055

  Product name: Recombinant human PTGS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 250-599 aa of BC029840

  Sequence: KLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL

• Full Name: prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
• Calculated Molecular Weight: 599 aa, 69 kDa
• Observed Molecular Weight: 60-72 kDa
• GenBank Accession Number: BC029840
• Gene Symbol: PTGS1
• Gene ID (NCBI): 5742
• RRID: AB_3671716
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P23219
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PTGS1(Prostaglandin G/H synthase 1) belongs to the prostaglandin G/H synthase family and catalyzes the conversion of arachidonic acid to prostaglandin H2, which is subsequently metabolized to various biologically active prostaglandins. It is also named as COX1(Cyclooxygenase-1). There is no PTGS1 expression in fetal samples (prostate, seminal vesicles, or ejaculatory ducts), and only minimal expression in adult tissues (PMID: 10999846). PTGS1 has some isoforms with MW of 56-72 kD and PTGS1 can form homodimer.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Exp Eye Res; Proanthocyanidins inhibit the inflammation response of dry eye by regulating IRAK4/JAK1/STAT1 signaling pathway.; Authors - Ying Lian