COX14 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX14 Polyclonal antibody, PBS Only (27712-1-PBS)

• 

  WB analysis using 27712-1-AP (same clone as 27712-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27712-1-AP (COX14 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27712-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 27712-1-AP (same clone as 27712-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COX14 antibody (27712-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 27712-1-PBS in a different storage buffer formulation.

COX14 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 27712-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

C12orf62

---

Product Information

27712-1-PBS targets COX14 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24036

  Product name: Recombinant human C12orf62 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-57 aa of BC007849

  Sequence: MPTGKQLADIGYKTFSTSMMLLTVYGGYLCSVRVYHYFQWRRAQRQAAEEQKTSGIM

• Full Name: Cytochrome c oxidase assembly protein COX14
• Observed Molecular Weight: 7-12 kDa
• GenBank Accession Number: BC007849
• Gene Symbol: C12orf62
• Gene ID (NCBI): 84987
• RRID: AB_3742250
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96I36
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX14 (Cytochrome c Oxidase Assembly Factor 14) is a protein that functions as a crucial assembly factor for mitochondrial complex IV (cytochrome c oxidase, COX), the terminal enzyme of the electron transport chain .