COX16 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX16 Polyclonal antibody, PBS Only (19425-1-PBS)

• 

  WB analysis using 19425-1-AP (same clone as 19425-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 19425-1-AP (COX16 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 19425-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 19425-1-AP (same clone as 19425-1-PBS)

  WB result of COX16 antibody (19425-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-COX16 transfected HeLa cells. This data was developed using the same antibody clone with 19425-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 19425-1-AP (same clone as 19425-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19425-1-AP (COX16 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19425-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 19425-1-AP (same clone as 19425-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 19425-1-AP (COX16 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19425-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 19425-1-AP (same clone as 19425-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using COX16 antibody (19425-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 19425-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COX16 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 19425-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C14orf112, COX 16, hCOX16, HSPC203, MC4DN22

---

Product Information

19425-1-PBS targets COX16 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13756

  Product name: Recombinant human COX16 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-106 aa of BC001702

  Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

• Full Name: COX16 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 106 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC001702
• Gene Symbol: COX16
• Gene ID (NCBI): 51241
• RRID: AB_10666854
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0S2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.