COX17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX17 Polyclonal antibody, PBS Only (11464-1-PBS)

• 

  WB analysis using 11464-1-AP (same clone as 11464-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11464-1-AP (COX17 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11464-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 11464-1-AP (same clone as 11464-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 11464-1-AP (COX17 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11464-1-AP (same clone as 11464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11464-1-AP (COX17 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11464-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 11464-1-AP (same clone as 11464-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11464-1-AP (COX17 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11464-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11464-1-AP (same clone as 11464-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX17 antibody (11464-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 11464-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COX17 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11464-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

11464-1-PBS targets COX17 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2032

  Product name: Recombinant human COX17 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-63 aa of BC010933

  Sequence: MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI

• Full Name: COX17 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 63 aa, 7 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC010933
• Gene Symbol: COX17
• Gene ID (NCBI): 10063
• RRID: AB_2085109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14061
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.