COX18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX18 Polyclonal antibody, PBS Only (18071-1-PBS)

• 

  WB analysis of mouse liver using 18071-1-AP (same clone as 18071-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18071-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 18071-1-AP (same clone as 18071-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18071-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 18071-1-AP (same clone as 18071-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 18071-1-AP (COX18 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 18071-1-AP (same clone as 18071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 18071-1-AP (COX18 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 18071-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 18071-1-AP (same clone as 18071-1-PBS)

  Immunofluorescent analysis of HepG2 cells, using COX18 antibody 18071-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 18071-1-PBS in a different storage buffer formulation.

COX18 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18071-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

OXA1L2, Cytochrome c oxidase assembly protein COX18, mitochondrial, COX18Hs

---

Product Information

18071-1-PBS targets COX18 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12709

  Product name: Recombinant human COX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 187-333 aa of BC101684

  Sequence: ALRNLSTGAAHSEGFSVQEQLATGGILWFPDLTAPDSTWILPISVGVINLLIVEICALQKIGMSRFQTYITYFVRAMSVLMIPIAATVPSSIVLYWLCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISRK

• Full Name: COX18 cytochrome c oxidase assembly homolog (S. cerevisiae)
• Calculated Molecular Weight: 333 aa, 37 kDa
• Observed Molecular Weight: 37-40 kDa, 28-30 kDa
• GenBank Accession Number: BC101684
• Gene Symbol: COX18
• Gene ID (NCBI): 285521
• RRID: AB_10638443
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8Q8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.