COX20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX20 Polyclonal antibody, PBS Only (25752-1-PBS)

• 

  WB analysis using 25752-1-AP (same clone as 25752-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25752-1-AP (COX20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25752-1-AP (same clone as 25752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 25752-1-AP (same clone as 25752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 25752-1-AP (same clone as 25752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 25752-1-AP (same clone as 25752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25752-1-AP (COX20 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25752-1-AP (same clone as 25752-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using COX20 antibody (25752-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 25752-1-AP (same clone as 25752-1-PBS)

  Immunofluorescent analysis of PC-3 cells using 25752-1-AP (COX20 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 25752-1-PBS in a different storage buffer formulation.

COX20 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

FAM36A, Cytochrome c oxidase assembly protein COX20, mitochondrial, FAM 36A

---

Product Information

25752-1-PBS targets COX20 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22520

  Product name: Recombinant human FAM36A protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-118 aa of BC018519

  Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN

• Full Name: family with sequence similarity 36, member A
• Calculated Molecular Weight: 118 aa, 13 kDa
• Observed Molecular Weight: ~16 kDa
• GenBank Accession Number: BC018519
• Gene Symbol: COX20
• Gene ID (NCBI): 116228
• RRID: AB_2880224
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5RI15
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX20, also name as FAM36A, belongs to the COX20 family. Mutations in COX20 are a novel cause of recessively inherited.