COX4NB Monoclonal antibody

• Home
• Products
• Primary Antibodies
• COX4NB Monoclonal antibody (66547-1-Ig)

COX4NB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66547-1-Ig Copied!

Clone No. 2B8D3

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

EMC8, C16orf2, C16orf4, COX4 neighbor, COX4AL

• 

  WB analysis using 66547-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66547-1-Ig (COX4NB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 66547-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 66547-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66547-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4NB antibody (66547-1-Ig, Clone: 2B8D3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX4NB in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66547-1-Ig targets COX4NB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13776

  Product name: Recombinant human COX4NB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC001472

  Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

• Full Name: COX4 neighbor
• Calculated Molecular Weight: 210 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001472
• Gene Symbol: COX4NB
• Gene ID (NCBI): 10328
• RRID: AB_2881909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43402
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The COX4NB Monoclonal antibody (2B8D3), catalog number 66547-1-Ig, has a total of 1 citation. The cited publication appeared in iScience (2022) and focused on the endoplasmic reticulum membrane complex's role in promoting proteostasis of GABAA receptors, using this antibody for Western blot in mouse samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	iScience; The endoplasmic reticulum membrane complex promotes proteostasis of GABAA receptors; Authors - Angela L. Whittsette