COX4NB Monoclonal antibody

• 

  WB analysis using 66547-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66547-1-Ig (COX4NB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 66547-1-Ig

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 66547-1-Ig

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 66547-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4NB antibody (66547-1-Ig, Clone: 2B8D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

COX4NB Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66547-1-Ig

Clone No.2B8D3

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

C16orf2, C16orf4, COX4 neighbor, COX4AL, COX4NB, FAM158B, Neighbor of COX4, NOC4, Protein FAM158B

---

Tested Applications

• Positive WB detected in: A549 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells
• Positive IHC detected in: human liver tissue, human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66547-1-Ig targets COX4NB in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13776

  Product name: Recombinant human COX4NB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC001472

  Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

• Full Name: COX4 neighbor
• Calculated Molecular Weight: 210 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001472
• Gene Symbol: COX4NB
• Gene ID (NCBI): 10328
• RRID: AB_2881909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43402
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	iScience; The endoplasmic reticulum membrane complex promotes proteostasis of GABAA receptors; Authors - Angela L. Whittsette