COX4NB Monoclonal antibody, PBS Only

• 

  WB analysis using 66547-1-Ig (same clone as 66547-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66547-1-Ig (COX4NB antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66547-1-Ig (same clone as 66547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66547-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 66547-1-Ig (same clone as 66547-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 66547-1-Ig (COX4NB antibody) at dilution of 1:400 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66547-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66547-1-Ig (same clone as 66547-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using COX4NB antibody (66547-1-Ig, Clone: 2B8D3 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66547-1-PBS in a different storage buffer formulation.

COX4NB Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66547-1-PBS

Clone No.2B8D3

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C16orf2, C16orf4, COX4 neighbor, COX4AL, COX4NB, FAM158B, Neighbor of COX4, NOC4, Protein FAM158B

---

Product Information

66547-1-PBS targets COX4NB in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13776

  Product name: Recombinant human COX4NB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-210 aa of BC001472

  Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC

• Full Name: COX4 neighbor
• Calculated Molecular Weight: 210 aa, 24 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: BC001472
• Gene Symbol: COX4NB
• Gene ID (NCBI): 10328
• RRID: AB_2881909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43402
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.