COX6A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• COX6A2 Polyclonal antibody (11421-1-AP)

• Featured Product
• KD/KO Validated

COX6A2 Polyclonal Antibody for IF-P, ELISA

Cat No. 11421-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF-P, CoIP, ELISA

Synonyms

Cytochrome c oxidase polypeptide VIa-heart, COXVIAH, COX6AH, COX6A, COX VIa-M

• 

  IF Staining of human heart using 11421-1-AP

  Immunofluorescent analysis of (4% PFA) fixed human heart tissue using 11421-1-AP (COX6A2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for COX6A2 in ?

Chat with Able

---

Tested Applications

• Positive IF-P detected in: human heart tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11421-1-AP targets COX6A2 in WB, IHC, IF-P, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1985

  Product name: Recombinant human COX6A2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC029818

  Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP

• Full Name: cytochrome c oxidase subunit VIa polypeptide 2
• Calculated Molecular Weight: 97 aa, 11 kDa
• GenBank Accession Number: BC029818
• Gene Symbol: COX6A2
• Gene ID (NCBI): 1339
• RRID: AB_11232029
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

COX6A2(Cytochrome c oxidase subunit 6A2, mitochondrial) is also named as COX6A, COX6AH and Belongs to the cytochrome c oxidase subunit 6A family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.

Publications

What published studies show

COX6A2 Polyclonal antibody (Cat# 11421-1-AP) has 4 citations. They appear in Nature Communications, Cell Death & Disease, Diabetes, and Journal of Biological Chemistry. Research fields include Alzheimer's disease (parvalbumin interneuron vulnerability), type 2 diabetes (pancreatic β-cell mitochondrial apoptosis), and glioma temozolomide chemoresistance (mitochondrial electron transport chain remodeling).

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nat Commun; Dual platform spatial transcriptomics reveals parvalbumin interneuron subtype vulnerability in mouse models of Alzheimer's disease.; Authors - Heewon Seo
mouse,rat	WB,CoIP	Cell Death Dis; FXR-regulated COX6A2 triggers mitochondrial apoptosis of pancreatic β-cell in type 2 diabetes; Authors - Lianqi Shao
mouse,rat	WB	Diabetes; Increased COX6A2 promotes pancreatic β-cell apoptosis and is suppressed in diabetic GK rats after Roux-en-Y gastric bypass; Authors - Xiangchen Kong ; KD Validated
human	WB	J Biol Chem; PMID: 20870728; Authors - Oliva Claudia R CR