COX8A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COX8A Polyclonal antibody, PBS Only (15368-1-PBS)

• 

  WB analysis of mouse skeletal muscle using 15368-1-AP (same clone as 15368-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15368-1-AP (COX8A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 15368-1-AP (same clone as 15368-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15368-1-AP (COX8A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 15368-1-AP (same clone as 15368-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 15368-1-AP (COX8A antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat heart using 15368-1-AP (same clone as 15368-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 15368-1-AP (COX8A antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 15368-1-AP (same clone as 15368-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15368-1-AP (COX8A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15368-1-AP (same clone as 15368-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15368-1-AP (COX8A antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human hepatocirrhosis using 15368-1-AP (same clone as 15368-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 15368-1-AP (COX8A antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 15368-1-PBS in a different storage buffer formulation.

COX8A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15368-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

COX8, COX8 2, COX8L, Cytochrome c oxidase polypeptide VIII-liver/heart, Cytochrome c oxidase subunit 8-2

---

Product Information

15368-1-PBS targets COX8A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2885

  Product name: Recombinant human COX8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-69 aa of BC063025

  Sequence: MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE

• Full Name: cytochrome c oxidase subunit 8A (ubiquitous)
• Calculated Molecular Weight: 8 kDa
• Observed Molecular Weight: 8 kDa
• GenBank Accession Number: BC063025
• Gene Symbol: COX8A
• Gene ID (NCBI): 1351
• RRID: AB_10697832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P10176
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

COX8A(Cytochrome c oxidase subunit 8A) is also named as COX8, COX8L and belongs to the cytochrome c oxidase VIII family. This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. The gene encodes a full length protein of 8 kDa with a transit peptide of 25 amino acid.