Ceruloplasmin Polyclonal antibody

• 

  WB analysis of human plasma using 21131-1-AP

  human blood were subjected to SDS PAGE followed by western blot with 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 21131-1-AP

  human plasma were subjected to SDS PAGE followed by western blot with 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21131-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human tonsillitis using 21131-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human tonsillitis using 21131-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 21131-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 21131-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human hepatocirrhosis using 21131-1-AP

  Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis tissue slide using 21131-1-AP (Ceruloplasmin antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

Ceruloplasmin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21131-1-AP

Publications(12)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

CP, CERU, Cuproxidase ceruloplasmin, EC:1.11.1.27, EC:1.11.1.9

---

Tested Applications

• Positive WB detected in: human blood tissue, mouse brain tissue, human plasma tissue
• Positive IHC detected in: human tonsillitis tissue, human colon tissue, human hepatocirrhosis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 10 publications below
• IHC: See 4 publications below
• IF: See 2 publications below

Product Information

21131-1-AP targets Ceruloplasmin in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15535

  Product name: Recombinant human CP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 194-446 aa of BC146663

  Sequence: IGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHL

• Full Name: ceruloplasmin (ferroxidase)
• Calculated Molecular Weight: 1065 aa, 122 kDa
• Observed Molecular Weight: 130-140 kDa, 85 kDa
• GenBank Accession Number: BC146663
• Gene Symbol: Ceruloplasmin
• Gene ID (NCBI): 1356
• RRID: AB_2878815
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00450
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ceruloplasmin (CP) is a serum glycoprotein synthesized by hepatocytes and functions as the major transport protein of copper in blood where it acts as ferrodoxidase and is required for iron transport of transferrin. The intact ceruloplasmin migrated around 130-140 kDa and some proteolytic cleaved fragments could also be observed.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); ITM2B Truncation Promotes Migrasome Formation to Accelerate Renal Cell Carcinoma Growth; Authors - Qi-Tao Chen
mouse,human	WB,IHC	Int J Biol Sci; Novel LncRNA LINC02936 Suppresses Ferroptosis and Promotes Tumor Progression by Interacting with SIX1/CP Axis in Endometrial Cancer; Authors - Zihui Zhang ; KD Validated
human	WB	Carcinogenesis; Identification of HCAR1 as a ferroptosis-related biomarker of gastric cancer based on a novel ferroptosis-related prognostic model and in vitro experiments; Authors - Hongjiao Zhang
mouse	WB,IF	Cell Death Dis; The divergent effects of astrocyte ceruloplasmin on learning and memory function in young and old mice; Authors - Zhong-Da Li
mouse	WB	iScience; Hepatic depletion of nucleolar protein mDEF causes excessive mitochondrial copper accumulation associated with p53 and NRF1 activation; Authors - Jinsong Wei
chicken	IHC,IF	J Agric Food Chem; Drp1 Aggravates Copper Nanoparticle-Induced ER-Phagy by Disturbing Mitochondria-Associated Membranes in Chicken Hepatocytes; Authors - Quanwei Li