Carboxypeptidase A2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Carboxypeptidase A2 Polyclonal antibody (15626-1-AP)

Carboxypeptidase A2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15626-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CPA2, EC:3.4.17.15

• 

  WB analysis of mouse pancreas using 15626-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 15626-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 15626-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas using 15626-1-AP (Carboxypeptidase A2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15626-1-AP targets Carboxypeptidase A2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8080

  Product name: Recombinant human CPA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 179-417 aa of BC014571

  Sequence: REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY

• Full Name: carboxypeptidase A2 (pancreatic)
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC014571
• Gene Symbol: Carboxypeptidase A2
• Gene ID (NCBI): 1358
• RRID: AB_2276735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48052
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carboxypeptidase A2 (CPA2) is a digestive enzyme that plays a specific role in protein breakdown by cleaving amino acids from the ends of peptides and proteins. CPA2 is a member of the M14 family of metallocarboxypeptidases, characterized by its dependence on a zinc ion (Zn²⁺) for catalytic activity

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Transl Oncol; Label-Free Quantitative Proteomics Unravels Carboxypeptidases as the Novel Biomarker in Pancreatic Ductal Adenocarcinoma.; Authors - Yang Song