CPA4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CPA4 Polyclonal antibody (26824-1-AP)

CPA4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 26824-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

Carboxypeptidase A3, Carboxypeptidase A4, CPA3, EC:3.4.17.-, UNQ694/PRO1339

• 

  WB analysis using 26824-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26824-1-AP (CPA4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 26824-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26824-1-AP (CPA4 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse kidney using 26824-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 26824-1-AP (CPA4 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 26824-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 26824-1-AP (CPA4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26824-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26824-1-AP (CPA4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 26824-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26824-1-AP (CPA4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CPA4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse kidney tissue, HepG2 cells
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26824-1-AP targets CPA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25327

  Product name: Recombinant human CPA4 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 316-384 aa of BC052289

  Sequence: YPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELR

• Full Name: carboxypeptidase A4
• Calculated Molecular Weight: 421 aa, 47 kDa
• Observed Molecular Weight: 44 kDa, 150 kDa
• GenBank Accession Number: BC052289
• Gene Symbol: CPA4
• Gene ID (NCBI): 51200
• RRID: AB_2880648
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UI42
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carboxypeptidase A4 (CPA4), a member of the metallocarboxypeptidase family, is a zinc-containing exopeptidase that catalyzes the release of carboxy-terminal amino acids. CPA4 was previously shown to play a crucial role in cell growth and differentiation by modulating or inactivating peptide hormone activity (PMID: 27904708). CPA4 expression is increased in multiple cancer tissues, including tissues from patients with pancreatic cancer, gastric cancer, esophageal squamous cell carcinoma, and lung cancer, and may serve as a potential diagnostic and prognostic marker (PMID: 31397502, 32922037).

Publications

What published studies show

The CPA4 Polyclonal antibody (Cat# 26824-1-AP) has 8 total citations. These appear in journals including Cell Death & Disease, Science Signaling, European Journal of Pharmacology, European Journal of Medical Research, Journal of Cellular and Molecular Medicine, Acta Biochimica Biophysica Sinica, PeerJ, and Antiviral Research. The associated research fields span cancer biology (endometrial, renal cell, breast, and glioblastoma cancers), pyroptosis and AKT signaling, angiogenesis/VEGF signaling, DNA methylation in recurrent miscarriage, and antiviral mechanisms. Applications cited include Western blot and immunohistochemistry.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell Death Dis; Carboxypeptidase A4 negatively regulates HGS-ETR1/2-induced pyroptosis by forming a positive feedback loop with the AKT signalling pathway; Authors - Luoling Wang
human	WB	Sci Signal; Hypoxic cancer-associated fibroblasts increase NCBP2-AS2/HIAR to promote endothelial sprouting through enhanced VEGF signaling.; Authors - Fernanda G Kugeratski
human	WB	Eur J Pharmacol; Mitochondrial dysfunction and senescence accompany glioblastoma cell death triggered by a putative metabolic inhibitor.; Authors - Anjali Yadav
human	IHC	Eur J Med Res; CPA4 overexpression correlates with poor prognosis and tumor progression in endometrial cancer; Authors - Kang He
human	IHC	J Cell Mol Med; CPA4 as a biomarker promotes the proliferation, migration and metastasis of clear cell renal cell carcinoma cells; Authors - Kongjia Wang
human	WB,IHC	Acta Biochim Biophys Sin (Shanghai); Angiopoietin-1 promotes triple-negative breast cancer cell proliferation by upregulating carboxypeptidase A4; Authors - Xue Liu