CoraLite®594-conjugated CPLX2 Monoclonal antibody

• 

  FC experiment of SH-SY5Y using CL594-66849

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug CoraLite®594 Anti-Human CPLX2 (CL594-66849, Clone:1B2A11) (red), or 0.4 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

CPLX2 Monoclonal Antibody for FC (Intra)

Cat No. CL594-66849

Clone No.1B2A11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

FC (Intra)

Synonyms

CPX 2, CPLX 2, Complexin-2, 921L, 921 L

---

Tested Applications

• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66849 targets CPLX2 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27949

  Product name: Recombinant human CPLX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-134 aa of BC093706

  Sequence: MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

• Full Name: complexin 2
• Calculated Molecular Weight: 134 aa, 15 kDa
• Observed Molecular Weight: 18-20 kDa
• GenBank Accession Number: BC093706
• Gene Symbol: CPLX2
• Gene ID (NCBI): 10814
• RRID: AB_3084732
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q6PUV4
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Complexins are soluble proteins that regulate the activity of soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) complexes necessary for vesicle fusion. Neuronal specific complexin 1 (CPLX1) has inhibitory and stimulatory effects on exocytosis by clamping trans-SNARE complexes in a prefusion state and promoting conformational changes to facilitate membrane fusion following cell stimulation. Complexin2 (CPLX2) is a pre-synaptic protein believed to regulate neurotransmitter release from pre-synaptic terminals, it is downregulated in schizophrenic patients suffering from depression, animal models of depression and neurological disorders such as Huntington's disease in which depression is a major symptom.