CPN1 Recombinant monoclonal antibody

CPN1 Recombinant Antibody for WB, IHC, IF-P, ELISA
Cat No. 84218-1-RR
Clone No.241481A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Kininase 1, EC:3.4.17.3, CPN, Arginine carboxypeptidase, ACBP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma
Positive IHC detected inmouse liver tissue, rat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)-PIF-P : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84218-1-RR targets CPN1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4035

Product name: Recombinant human CPN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-458 aa of BC027897

Sequence: RNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA

Predict reactive species
Full Name carboxypeptidase N, polypeptide 1
Calculated Molecular Weight 458 aa, 52 kDa
Observed Molecular Weight40~50 kDa
GenBank Accession NumberBC027897
Gene Symbol CPN1
Gene ID (NCBI) 1369
RRIDAB_3671774
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15169
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human carboxypeptidase N (CPN), a member of the CPN/E subfamily of "regulatory" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain. The C terminal region of the CPN1 subunit differs from all other family members in that it contains numerous basic residues. Proteolysis at these sites apparently happens either constitutively in the blood or during processing and secretion from the liver.

Protocols

Product Specific Protocols
IF protocol for CPN1 antibody 84218-1-RRDownload protocol
IHC protocol for CPN1 antibody 84218-1-RRDownload protocol
WB protocol for CPN1 antibody 84218-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...