CPN1 Recombinant monoclonal antibody, PBS Only (Detector)

CPN1 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA
Cat No. 84218-1-PBS
Clone No.241481A5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

241481A5, ACBP, Arginine carboxypeptidase, CPN, EC:3.4.17.3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84218-1-PBS targets CPN1 as part of a matched antibody pair:

MP01152-1: 84218-2-PBS capture and 84218-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4035

Product name: Recombinant human CPN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-458 aa of BC027897

Sequence: RNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA

Predict reactive species
Full Name carboxypeptidase N, polypeptide 1
Calculated Molecular Weight 458 aa, 52 kDa
Observed Molecular Weight40~50 kDa
GenBank Accession NumberBC027897
Gene Symbol CPN1
Gene ID (NCBI) 1369
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15169
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Human carboxypeptidase N (CPN), a member of the CPN/E subfamily of "regulatory" metallo-carboxypeptidases, is an extracellular glycoprotein synthesized in the liver and secreted into the blood, where it controls the activity of vasoactive peptide hormones, growth factors and cytokines by specifically removing C-terminal basic residues. Normally, CPN circulates in blood plasma as a hetero-tetramer consisting of two 83 kDa (CPN2) domains each flanked by a 48 to 55 kDa catalytic (CPN1) domain. The C terminal region of the CPN1 subunit differs from all other family members in that it contains numerous basic residues. Proteolysis at these sites apparently happens either constitutively in the blood or during processing and secretion from the liver.

Loading...
||
New chat Able
正在加载,请稍候...