Use Able AI chat for product recommendations

CoraLite®594-conjugated CPT1B Recombinant monoclonal antibody

CPT1B Uni-rAb® Recombinant Antibody for IF-P

Cat No. CL594-82701-3
Clone No.242881B6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

IF-P

Carnitine O palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase I-like protein, CPT1 M

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-82701-3 targets CPT1B in IF-P applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17840

Product name: Recombinant human CPT1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-250 aa of BC131570

Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF

Predict reactive species
Full Name carnitine palmitoyltransferase 1B (muscle)
Calculated Molecular Weight 567 aa, 64 kDa
Observed Molecular Weight 70-85 kDa
GenBank Accession NumberBC131570
Gene Symbol CPT1B
Gene ID (NCBI) 1375
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92523
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CPT1B (carnitine palmitoyltransferase 1B) is an isoform of the mitochondrial enzyme carnitine palmitoyltransferase 1, primarily expressed in skeletal muscle and heart tissues, where it plays a critical role in the regulation of long-chain fatty acid oxidation. By catalyzing the conversion of long-chain acyl-CoA to acyl-carnitine, which is then transported into the mitochondrial matrix for β-oxidation, CPT1B serves as a rate-limiting enzyme in energy metabolism, particularly under conditions of high energy demand such as exercise. Its activity is allosterically inhibited by malonyl-CoA, allowing tight metabolic control, and genetic variations or dysregulation of CPT1B have been implicated in metabolic disorders, insulin resistance, and obesity, highlighting its importance in maintaining systemic energy homeostasis.

Protocols

Product Specific Protocols
IF protocol for CL594 CPT1B antibody CL594-82701-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...