CD35 Polyclonal antibody

• 

  WB analysis using 30057-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30057-1-AP (CD35 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

CD35 Polyclonal Antibody for WB, ELISA

Cat No. 30057-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

KN, CR1, Complement receptor type 1, C3BR, C3b/C4b receptor

---

Tested Applications

• Positive WB detected in: TF-1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30057-1-AP targets CD35 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30243

  Product name: Recombinant human CR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1740-1971 aa of NM_000573

  Sequence: DEGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHD

• Full Name: complement component (3b/4b) receptor 1 (Knops blood group)
• Calculated Molecular Weight: 224 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: NM_000573
• Gene Symbol: CR1
• Gene ID (NCBI): 1378
• ENSEMBL Gene ID: ENSG00000203710
• RRID: AB_3086221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17927
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CD35, also known as complement receptor type 1 (CR1) or C3b/C4b receptor, is a single-chain glycoprotein consisting of 30 repeating homologous protein domains known as short consensus repeats (~60 amino acids each) followed by transmembrane and cytoplasmic domains (PMID: 8765013). CD35 is variably expressed by granulocytes, monocytes, B cells, some T cells, erythrocytes, follicular dendritic cells, Langerhans cells, and glomerular podocytes (PMID: 19004497). CD35 acts as a receptor for C3b and C4b and plays important roles in the regulation of the complement cascade and clearance of immune complexes. A soluble form of CD35 has been found in plasma (PMID: 3156931). It has been reported that soluble CD35 is produced by a proteolytic cleavage in the C-terminal region of CD35 transmembrane domain (PMID: 9405292).