Use Able AI chat for product recommendations
  • Featured Product

CRAT Polyclonal antibody

CRAT Polyclonal Antibody for WB, IHC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IP, CoIP, ELISA

CACP, Carnitine acetylase, Carnitine O-acetyltransferase, CAT, CAT1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CRAT in ?

Tested Applications

Positive WB detected inmouse skeletal muscle tissue, mouse heart tissue, rat skeletal muscle, rat heart tissue
Positive IP detected inmouse skeletal muscle tissue
Positive IHC detected inmouse brain tissue, mouse liver tissue, rat skeletal muscle tissue, human heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:800-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15170-1-AP targets CRAT in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, sheep, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7422

Product name: Recombinant human CRAT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-281 aa of BC000723

Sequence: MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSEEEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSPGVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSCRVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSSLQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQK

Predict reactive species
Full Name carnitine acetyltransferase
Calculated Molecular Weight 71 kDa
Observed Molecular Weight 62-68 kDa
GenBank Accession NumberBC000723
Gene Symbol CRAT
Gene ID (NCBI) 1384
RRIDAB_2229978
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP43155
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRAT, also named as CAT1, belongs to the carnitine/choline acetyltransferase family. It is specific for short chain fatty acids. CRAT seems to affect the flux through the pyruvate dehydrogenase complex. It may be involved as well in the transport of acetyl-CoA into mitochondria. Carnitine palmitoyltransferase (CPT) deficiencies are common disorders of mitochondrial fatty acid oxidation. The CPT system is made up of two separate proteins located in the outer (CPT1) and inner (CPT2) mitochondrial membranes. CRAT is an active forms for carnitine acetyltransferase. This antibody can bind the close sequences genes.

Protocols

Product Specific Protocols
IHC protocol for CRAT antibody 15170-1-APDownload protocol
IP protocol for CRAT antibody 15170-1-APDownload protocol
WB protocol for CRAT antibody 15170-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The CRAT Polyclonal antibody (Cat# 15170-1-AP) has 20 citations published in journals including Nature Metabolism, Nature Communications, Cell Metabolism, Cancer Research, Science Advances, Diabetes, and Molecular Metabolism. The research fields span mitochondrial metabolism, lipid metabolism, cardiovascular disease, insulin resistance, obesity, cancer (prostate, breast, cervical), diabetes, aging, and muscle physiology. Applications cited include WB, IHC, and CoIP across human, mouse, rat, pig, sheep, and goat species.

SpeciesApplicationTitle
ratWB

Cell Metab

Dissociation of Muscle Insulin Resistance from Alterations in Mitochondrial Substrate Preference.

Authors - Joongyu D Song
mouseWB

Nat Metab

CRAT links cholesterol metabolism to innate immune responses in the heart

Authors - Hua Mao
  • KO Validated

Cancer Res

Organelle-Derived Acetyl-CoA Promotes Prostate Cancer Cell Survival, Migration, and Metastasis via Activation of Calmodulin Kinase II.

Authors - Guoyu Yu
mouseWB

Nat Commun

Male obesity causes adipose mitochondrial dysfunction in F(1) mouse progeny via a let-7-DICER axis.

Authors - Chien Huang
mouseWB

Nat Commun

Pyruvate metabolism enzyme Dlat induces mitochondria protein hyperacetylation to limit fatty acid oxidation in the HFpEF heart.

Authors - Ying Wang
goatWB

Redox Biol

TGF-β1 attenuates mitochondrial bioenergetics in pulmonary arterial endothelial cells via the disruption of carnitine homeostasis.

Authors - Xutong Sun
  • KD Validated
Loading...
||
New chat

Able™

正在加载,请稍候...