CRB1 Polyclonal antibody

• 

  IHC staining of mouse eye using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse eye using 26598-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse eye tissue slide using 26598-1-AP (CRB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse eye using 26598-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using CRB1 antibody (26598-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 26598-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using CRB1 antibody (26598-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

CRB1 Polyclonal Antibody for IHC, IF/ICC, IF-P, ELISA

Cat No. 26598-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IF-P, ELISA

Synonyms

Crumbs homolog 1, crumbs homolog 1 (Drosophila), LCA8, Protein crumbs homolog 1, RP12

---

Tested Applications

• Positive IHC detected in: mouse eye tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse eye tissue
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26598-1-AP targets CRB1 in IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24512

  Product name: Recombinant human CRB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-188 aa of BC136271

  Sequence: NNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQGRHCDLEVD

• Full Name: crumbs homolog 1 (Drosophila)
• Calculated Molecular Weight: 1406 aa, 154 kDa
• Observed Molecular Weight: 150 kDa
• GenBank Accession Number: BC136271
• Gene Symbol: CRB1
• Gene ID (NCBI): 23418
• RRID: AB_2918104
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P82279
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRB1, also known as protein crumbs homolog 1, is homologous to Drosophila Crumbs, a protein that is essential for establishing and maintaining apico-basal polarity in epithelia derived from the ectoderm (PMID: 2344615). CRB1 protein is a single transmembrane protein with a large extracellular part, containing three laminin A G domains and 19 epidermal growth-factor-like domains (PMID: 15494026, 18407265, 11734541). The expression of CRB1 is restricted to the retina and brain (PMID: 10508521). Mutations in CRB1 gene cause severe retinal dystrophies, ranging from retinitis pigmentosa (RP) to Leber congenital amaurosis (LCA) (PMID: 11734541).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Danyun (Verified Customer) (09-03-2025)

Excellent!

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1:400
• Cell Tissue Type: retinal organoids