CREB3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CREB3 Polyclonal antibody (11275-1-AP)

• Featured Product
• KD/KO Validated

CREB3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 11275-1-AP Copied!

Publications (25)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, IP, ChIP, ELISA

Synonyms

Luman, Leucine zipper protein, Cyclic AMP-responsive element-binding protein 3, CREB-3, CREB 3

• 

  WB analysis of Jurkat using 11275-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11275-1-AP (CREB3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11275-1-AP

  WB result of CREB3 antibody (11275-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CREB3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11275-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11275-1-AP (CREB3 antibody) at dilution of 1:50 (under 25x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of U2OS using 11275-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CREB3 antibody (11275-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CREB3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11275-1-AP targets CREB3 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1823

  Product name: Recombinant human CREB3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-371 aa of BC009402

  Sequence: MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG

• Full Name: cAMP responsive element binding protein 3
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 40-64 kDa
• GenBank Accession Number: BC009402
• Gene Symbol: CREB3
• Gene ID (NCBI): 10488
• RRID: AB_10640533
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43889
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CREB3, also named as LZIP and Luman, belongs to the bZIP family and ATF subfamily. It is a transcription factors activated upon intramembrane proteolysis (RIP), binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3'), a sequence present in many viral and cellular promoters. CREB3 binds to and requires HCFC1 as a coactivator. The activity and expression are suppressed when the HCFC1-CREB3 complex binds with CREBZF. Participates in LKN-1/CCL15-induced chemotaxis signaling. CREB3 is N-glycosylated and released by proteolysis. So the MW of CREB3 emirate 40kd to 64kd (PMID: 12138176).

Publications

What published studies show

The anti-CREB3 antibody (Cat# 11275-1-AP) has 25 citations spanning journals including Nature Communications, Science Advances, Experimental Molecular Medicine, Free Radical Biology and Medicine, Carcinogenesis, FEBS Letters, Cell Molecular Life Science, International Journal of Molecular Sciences, Translational Oncology, Cancers, Viruses, Molecular Biology Reports, Frontiers in Molecular Neuroscience, and others. Research fields cover neurodegeneration (ALS), Golgi/ER stress, cancer biology (colorectal, hepatocellular, prostate, glioma), metabolic reprogramming, autophagy, ferroptosis, drug resistance, viral infection, and lipid metabolism.

Automatically generated from the 25 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; CREB3 gain of function variants protect against ALS; Authors - Salim Megat
human	ChIP	Nat Commun; Golgi stress induces SIRT2 to counteract Shigella infection via defatty-acylation.; Authors - Miao Wang
human	WB	Exp Mol Med; Dysregulated CREB3 cleavage at the nuclear membrane induces karyoptosis-mediated cell death; Authors - Ga-Eun Lee
human	WB	Sci Adv; Standalone or combinatorial phenylbutyrate therapy shows excellent antiviral activity and mimics CREB3 silencing.; Authors - Tejabhiram Yadavalli ; KD Validated
mouse,human	WB	Free Radic Biol Med; Heme oxygenase-1 attenuates sepsis-associated acute lung injury by suppressing the CREB3/ARF4 signaling pathway to mitigate Golgi stress in macrophages.; Authors - Chang Kong ; KO Validated
mouse	WB,IP,ChIP	Sci Signal; High glucose impairs cognitive function through Creb3 O-GlcNAcylation and increased lactate production.; Authors - Jingxi Xu