CREB5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CREB5 Polyclonal antibody, PBS Only (14196-1-PBS)

• 

  WB analysis of HepG2 using 14196-1-AP (same clone as 14196-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14196-1-AP (CREB5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14196-1-AP (same clone as 14196-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 14196-1-AP (CREB5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 14196-1-AP (same clone as 14196-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14196-1-AP (CREB5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14196-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 14196-1-AP (same clone as 14196-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 14196-1-AP (CREB5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14196-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CREB5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14196-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

CRE-BPa, CREBPA, CREB-5, CREB 5, cAMP-responsive element-binding protein 5

---

Product Information

14196-1-PBS targets CREB5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5399

  Product name: Recombinant human CREB5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-369 aa of BC059400

  Sequence: MFCTSGGNSASVMSMRPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSSIMGMQGPNLSNPCASPQVQPMHSEAKMRLKAALTHHPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYLSPESSPPASPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTTHRTDLNPIL

• Full Name: cAMP responsive element binding protein 5
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC059400
• Gene Symbol: CREB5
• Gene ID (NCBI): 9586
• RRID: AB_2083832
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02930
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

cyclic AMP responsive element binding protein 5 (CREB5), also known as CRE-BPA, a member of the cAMP response element binding protein family, is a transcription factor specifically expressed in superficial zone articular chondrocytes and is required for TGF-β and EGFR signaling. Knockdown of CREB5 decreased the c-jun and c-fos expression levels in HC-a cells (PMID: 38549717). Increased CREB5 expression is positively correlated with tumor cell invasion and a poor prognosis for cancer patients with epithelial ovarian cancer and hepatocellular carcinoma (PMID: 38418476).This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified (PMID: 33712729).