CREG2 Polyclonal antibody

• 

  IHC staining of mouse brain using 28236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28236-1-AP (CREG2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 28236-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28236-1-AP (CREG2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 28236-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using CREG2 antibody (28236-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

CREG2 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 28236-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, ELISA

Synonyms

Protein CREG2

---

Tested Applications

• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28236-1-AP targets CREG2 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28242

  Product name: Recombinant human CREG2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 42-215 aa of BC032949

  Sequence: VTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAHLRPRAGAARARQPPAPPGMFSYRREGGQTASAPPGPRLRAATARSLAHASVWGCLATVSTHKKIQGLPFGNCLPVSDGPFNNSTGIPFFYMTAKDPVVADLMKNPMASLMLPESEGEFCRKNIVDPEDPRC

• Full Name: cellular repressor of E1A-stimulated genes 2
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: BC032949
• Gene Symbol: CREG2
• Gene ID (NCBI): 200407
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUH2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The cellular repressor of E1A-stimulated genes (CREG) is a secreted glycoprotein that promotes the differentiation of pluripotent stem cells. CREG2 is a promising biological indicator because it plays an important role in increasing the migratory and proliferative capacity of lung adenocarcinoma (LUAD) cells (PMID: 40676398).