Tested Applications
| Positive WB detected in | rat testis tissue, mouse thymus tissue, rat thymus tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | human prostate cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12131-1-AP targets CREM in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2775 Product name: Recombinant human CREM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC017117 Sequence: MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL Predict reactive species |
| Full Name | cAMP responsive element modulator |
| Calculated Molecular Weight | 332 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC017117 |
| Gene Symbol | CREM |
| Gene ID (NCBI) | 1390 |
| RRID | AB_2084260 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03060 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclic AMP-responsive element modulator (CREM) is a transcription factor highly expressed in the post-meiotic germ cells of the testis. Its pivotal role is to regulate the expression of several germ cell-specific genes, a crucial function as demonstrated by the severe phenotype of mice whose CREM gene was mutated by homologous recombination. CREM-deficient male animals are sterile and display a ten-fold increase in the apoptosis of germ cells. Recent results have shown that CREM needs a tissue-specific co-activator, ACT (activator of CREM in testis) to elicit its regulatory function in testis (PMID: 10824972). Also, CREM is a crucial regulator of NK cell function. CREM exerts its regulatory functions through epigenetic reprogramming of CAR-NK cells (PMID: 40468083).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CREM antibody 12131-1-AP | Download protocol |
| IP protocol for CREM antibody 12131-1-AP | Download protocol |
| WB protocol for CREM antibody 12131-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CREM Polyclonal antibody (Cat# 12131-1-AP) has 10 citations published in journals including Nature, Advanced Science, Cell Communication and Signaling, Biofabrication, Biochemical Pharmacology, Life Sciences, International Journal of Molecular Sciences, and Toxicology and Applied Pharmacology. Research fields span spermatogenesis, Sertoli cell biology, testicular organoids, copper signaling and inflammation, breast cancer radioresistance, and reproductive toxicology.
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) Ex Vivo Spatiotemporal Characterization of Spermatogenesis in Mouse Testicular Organoids. | ||
Cell Commun Signal Paternal Sertoli cell-derived extracellular vesicles transfer mtDNA and microRNA cargo to trigger germ cell oxidative stress and induce metabolic risks in offspring. | ||
Biofabrication Testis on a chip - a microfluidic 3-dimensional culture system for the development of spermatogenesisin-vitro. | ||
Biochem Pharmacol CREM-activated LTBP1 transcription promotes radioresistance and immune escape in triple-negative breast cancer.
| ||
Life Sci Adrenocorticotropic hormone and its receptor as a novel testicular system involves in the development of spermatogenesis |
