CRIPT Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CRIPT Polyclonal antibody, PBS Only (11211-1-PBS)

• 

  WB analysis of L02 using 11211-1-AP (same clone as 11211-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 11211-1-AP (CRIPT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11211-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 11211-1-AP (same clone as 11211-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 11211-1-AP (CRIPT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11211-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 11211-1-AP (same clone as 11211-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 11211-1-AP (CRIPT antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11211-1-PBS in a different storage buffer formulation.

• 

  IP experiment of L02 using 11211-1-AP (same clone as 11211-1-PBS)

  IP result of anti-CRIPT (IP:11211-1-AP, 4ug; Detection:11211-1-AP 1:500) with L02 cells lysate 1800ug. This data was developed using the same antibody clone with 11211-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 11211-1-AP (same clone as 11211-1-PBS)

  Immunofluorescent analysis of L02 cells using 11211-1-AP (CRIPT antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 11211-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CRIPT Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 11211-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

11211-1-PBS targets CRIPT in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1708

  Product name: Recombinant human CRIPT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC018653

  Sequence: MVCEKCEKKLGTVITPDTWKDGARNTTESGGRKLNENKALTSKKARFDPYGKNKFSTCRICKSSVHQPGSHYCQGCAYKKGICAMCGKKVLDTKNYKQTSV

• Full Name: cysteine-rich PDZ-binding protein
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC018653
• Gene Symbol: CRIPT
• Gene ID (NCBI): 9419
• RRID: AB_2084731
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P021
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The clustering and immobilization of receptors and ion channels located at specific subcellular sites are believed to be mediated by intracellular proteins that attach these membrane proteins to the cytoskeleton. Receptors and ion channels interact with cytoplasmic proteins, which involved in the modulation or downstream signaling mechanisms of the receptor/ion channel. CRIPT is the protein that binds to the third PDZ (PDZ3) domain of PSD95, which binds to and clusters a variety of membrane proteins, including Shaker-type potassium channel subunits and NMDA receptor NR2 subunits, via its first 2 N-terminal PDZ domains