Anti-Human CRLF2 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human monocyte-derived mature dendritic cells using 98415-1-RR (same clone as 98415-1-PBS)

  1x10^6 human monocyte-derived mature dendritic cells were surface stained with 0.25 ug Anti-Human CRLF2 Rabbit RecAb (98415-1-RR, Clone: 243090E1) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98415-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected CHO using 98415-1-RR (same clone as 98415-1-PBS)

  1x10^6 CHO cells or CRLF2-transfected CHO cells were surface stained with 0.25 ug Anti-Human CRLF2 Rabbit RecAb (98415-1-RR, Clone: 243090E1) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98415-1-PBS in a different storage buffer formulation.

• 

  FC experiment of Transfected CHO using 98415-1-RR (same clone as 98415-1-PBS)

  1x10^6 CHO cells or CRLF2-transfected CHO cells were surface stained with 0.25 ug Anti-Human CRLF2 Rabbit RecAb (98415-1-RR, Clone: 243090E1) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed. This data was developed using the same antibody clone with 98415-1-PBS in a different storage buffer formulation.

CRLF2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98415-1-PBS

Clone No.243090E1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CRL2, CRLF2Y, IL XR, ILXR, TSLP receptor

---

Product Information

98415-1-PBS targets CRLF2 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2626

  Product name: Recombinant Human CRLF2 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-231 aa of NM_022148.3

  Sequence: GAAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSK

• Full Name: cytokine receptor-like factor 2
• Calculated Molecular Weight: 42 kDa
• GenBank Accession Number: NM_022148.3
• Gene Symbol: CRLF2
• Gene ID (NCBI): 64109
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HC73
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytokine receptor-like factor 2 (CRLF2), also known as the thymic stromal derived lymphopoietin receptor (TSLPR), which in combination with the interleukin 7 receptor a chain (IL-7R) forms the receptor for thymic stromal lymphopoietin. CRLF2 is a type I cytokine receptor. CRLF2 rearrangements occur either as a translocation to the immunoglobulin heavy-chain enhancer region (IGH-CRLF2) or by a deletion of upstream PAR1 that leads to joining of CRLF2 to adjacent P2RY8. CRLF2 is expressed in heart, skeletal muscle, kidney and adult and fetal liver and is primarily expressed in dendrites and monocytes. (PMID: 20807819; 31644323; 33485429)