CROP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CROP Recombinant monoclonal antibody (86690-1-RR)

• 

  WB analysis using 86690-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86690-1-RR (CROP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86690-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86690-1-RR (CROP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 86690-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CROP antibody (86690-1-RR, Clone: 251672C12 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86690-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86690-1-RR against Human CROP were performed. The affinity constant is 3.07 nM.

CROP Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86690-1-RR

Clone No.251672C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

cAMP regulatory element-associated protein 1, Cisplatin resistance-associated-overexpressed protein, CRE associated protein 1, CREAP 1, CREAP1

---

Tested Applications

• Positive WB detected in: Jurkat cells, RT-4 cells, HepG2 cells, mouse brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86690-1-RR targets CROP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5961

  Product name: Recombinant human CROP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC056409

  Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLDVFGRGDNISDVSKFLEDDKWMEE

• Full Name: cisplatin resistance-associated overexpressed protein
• Calculated Molecular Weight: 51 kDa
• Observed Molecular Weight: 55-58 kDa
• GenBank Accession Number: BC056409
• Gene Symbol: CROP
• Gene ID (NCBI): 51747
• RRID: AB_3745055
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95232
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CROP, a putative SR protein, contain cystine/histidine motifs and leucine zipper-like repeats in the N-terminal half and consists mostly of charged and polar amino acids in the C-terminal half. CROP has a high expression in heart, brain, pancreas, thymus, and weak in lung, live and kidney. As the human homologue of yeast Luc7p, CROP is supported to be participated in 5'-splice site recognize and is essential for vegetative growth. This antibody raised against part of N-terminus of CROP of human origin, and can recognize a ~58kDa band of CROP.